Essential Linux Commands for Day-to-Day Life
This compilation features 50 crucial Linux commands, organized by their relevance in everyday use. These commands are indispensable for tasks such as file management, text editing, and basic system operations. Keep in mind that the significance of each command can vary based on your specific role and the tasks you frequently undertake. Whether you’re a system administrator, developer, or casual user, your list of essential commands might differ.
lscdpwdcpmvrmmkdircatlessgrepsudosshmannanovimtouchchmodchownpstopkillapt/yum/dnfwgetcurlpingifconfig/iptargzipunzipfinddfdufreehistorypasswdunamedatewhoamiwhichaliasechotailheaddiffwcsortuniqsedawkcut1. ls - List directory contents
The ls command in Linux is used to list the contents of a directory. It shows the files, folders, and other items located in the specified directory. By default, if no directory is specified, it lists the contents of the current directory.
Basic Syntax:
This command lists all the files and directories in the current directory.
lsExamples:
-l: Displays detailed information (permissions, owner, size, modification time) about each file or directory.
ls -l-a: Shows all files, including hidden ones (those that start with a dot .).
ls -a-h: Used with -l to show file sizes in human-readable format (e.g., KB, MB).
ls -lh-R: Recursively lists contents of all subdirectories.
ls -R2. cd - Change directory
The cd command in Linux stands for change directory. It allows you to navigate between different directories (folders) in the file system.
Basic Syntax:
cd [directory]Where [directory] is the path to the directory you want to switch to.
Examples:
Change to a specific directory:
cd /home/user/DocumentsThis command moves you to the Documents directory inside the /home/user folder.
Change to the home directory: Simply type cd with no arguments, and it will take you to your user's home directory:
cdGo to the parent directory: To move up one directory level (to the parent folder):
cd ..Return to the previous directory: To switch back to the last directory you were in:
cd -Navigate to a relative path: If you are in /home/user/, and you want to go to the Documents folder inside it, you can use:
cd DocumentsNotes:
-
Paths can be absolute (starting from the root /) or relative (starting from the current location).
-
You can use ~ to represent the home directory. For example:
cd ~/Downloads3. pwd - Print working directory
The pwd command in Linux stands for Print Working Directory. It shows the full path of the directory you are currently in. This is useful when you want to know your exact location within the filesystem.
Basic Syntax:
pwdIf you're inside the /home/user/Documents directory, this command will output:
/home/user/DocumentsUse Case:
-
Confirm current directory: When you're navigating through directories and want to verify where you are.
-
Absolute path reference: It helps you determine the complete path to your current location, which is important for scripts or referencing files.
Examples:
-P: Displays the physical path by resolving symbolic links.
pwd -P-L: Displays the logical path, showing any symbolic links (this is usually the default behavior).
pwd -LSummary:
The pwd command tells you exactly which directory you're in, showing its absolute path from the root (/).
4. cp - Copy files or directories
The cp command in Linux is used to copy files and directories from one location to another. It can copy single files, multiple files, or entire directories.
Basic Syntax:
cp [options] source destination-
source: The file or directory you want to copy. -
destination: The location where you want the file or directory to be copied.
Examples:
cp file1.txt /home/user/Documents/This command copies file1.txt to the /home/user/Documents/ directory.
-r or -R: Copy directories recursively (copy all contents inside a directory). Without this option, cp only copies files.
cp -r /source/directory /destination/directoryThis will copy everything from /source/directory to /destination/directory.
-i: Prompt before overwriting an existing file in the destination.
cp -i file1.txt /home/user/Documents/If file1.txt already exists in /home/user/Documents/, you'll be asked whether to overwrite it.
-v: Verbose mode, which shows each file being copied.
cp -v file1.txt /home/user/Documents/This will display output like:
'file1.txt' -> '/home/user/Documents/file1.txt'-u: Copy only if the source file is newer than the destination file, or if the destination file doesn't exist.
cp -u file1.txt /home/user/Documents/-p: Preserve file attributes like timestamps, ownership, and permissions while copying.
cp -p file1.txt /home/user/Documents/Copy a file to a different directory:
cp myfile.txt /home/user/backup/Copy multiple files to a directory:
cp file1.txt file2.txt /home/user/Documents/Copy an entire directory and its contents:
cp -r /home/user/project /backup/project_backup/Summary:
-
The
cpcommand is used for copying files or directories. -
You can copy individual files, multiple files, or entire directories recursively.
-
Options like
-i(interactive),-r(recursive),-v(verbose), and-p(preserve attributes) offer more control over the copy process.
5. mv - Move or rename files or directories
The mv command in Linux is used to move or rename files and directories. It either relocates a file/directory to a different location or renames it in the same directory. The behavior depends on whether the destination is a new or existing path.
Basic Syntax:
mv [options] source destination-
source: The file or directory you want to move or rename. -
destination: The new location or the new name for the file or directory.
Examples:
Move a file to a new directory:
mv file1.txt /home/user/Documents/This moves file1.txt to the /home/user/Documents/ directory.
Rename a file:
mv oldname.txt newname.txtThis renames oldname.txt to newname.txt within the same directory.
-i: Interactive mode. Prompts before overwriting an existing file in the destination.
mv -i file1.txt /home/user/Documents/If file1.txt already exists in the /home/user/Documents/ directory, you'll be asked whether to overwrite it.
-f: Force overwrite of the destination file without prompting.
mv -f file1.txt /home/user/Documents/This will overwrite any existing file1.txt in the destination directory without warning.
-n: Prevents overwriting files in the destination.
mv -n file1.txt /home/user/Documents/-v: Verbose mode. Shows the details of the move/rename operation.
mv -v file1.txt /home/user/Documents/Output:
'file1.txt' -> '/home/user/Documents/file1.txt'Move multiple files to a directory:
mv file1.txt file2.txt /home/user/Documents/Moves file1.txt and file2.txt to /home/user/Documents/.
Rename a directory:
mv old_directory new_directoryRenames old_directory to new_directory.
Move and rename a file:
mv file1.txt /home/user/Documents/newfile.txtThis moves file1.txt to the /home/user/Documents/ directory and renames it to newfile.txt.
Move a directory and its contents:
mv /source/directory /destination/directoryMoves the entire directory from /source/ to /destination/.
Summary:
-
The
mvcommand is used to move files/directories to another location or rename them. -
It doesn’t copy the file—it physically relocates it (unlike
cp). -
It can also be used interactively (
-i), forcefully (-f), or with verbose output (-v).
6. rm - Remove files or directories
The rm command in Linux is used to remove (delete) files or directories. By default, it only removes files, but with the right options, it can delete directories and their contents as well.
Basic Syntax:
rm [options] file-
file: The file(s) or directory you want to remove.
Examples:
rm file1.txtThis removes the file file1.txt from the current directory.
-r or -R: Recursively remove directories and their contents. This is necessary when deleting directories.
rm -r directory/This command deletes the directory named directory and all of its contents (subdirectories, files).
-f: Force removal without prompting for confirmation, even if the files are write-protected.
rm -f file1.txtThis removes file1.txt without asking for confirmation, even if the file is write-protected.
-i: Interactive mode, which prompts for confirmation before each file is deleted.
rm -i file1.txtThe system will ask: rm: remove regular file 'file1.txt'?, and you can respond with y (yes) or n (no).
-v: Verbose mode. Displays what is being deleted.
rm -v file1.txtThis will output:
removed 'file1.txt'-rf or -r -f: Combine recursive and force options to delete a directory and its contents without confirmation.
rm -rf directory/This forcefully removes the directory and everything inside it without asking for confirmation.
Remove a single file:
rm file1.txtRemove multiple files:
rm file1.txt file2.txt file3.txtRemove a directory and all its contents:
rm -r mydir/This removes the directory mydir and everything inside it (including subdirectories and files).
Force-remove files without prompts:
rm -f file1.txtThis deletes file1.txt without asking for confirmation, even if the file is write-protected.
Recursively and forcefully remove a directory:
rm -rf /home/user/old_project/This will forcefully and recursively delete the old_project directory and everything inside it.
Important Warning:
-
rm does not move files to the trash/recycle bin, it permanently deletes them. Be cautious when using rm, especially with the -r and -f options, as it can delete large amounts of data without recovery options.
Summary:
-
The
rmcommand is used to delete files and directories. -
Use
-rfor recursive deletion of directories, and-fto force deletion without confirmation. -
Always use caution, especially when combining
-rand-foptions, as it can result in irreversible deletion of directories and files.
7. mkdir - Make directory
The mkdir command in Linux stands for Make Directory. It is used to create one or more new directories (folders) in the file system.
Basic Syntax:
mkdir [options] directory_name-
directory_name: The name of the directory you want to create.
Examples:
mkdir mydirThis creates a directory named mydir in the current location.
-p: Create parent directories as needed. This option allows you to create a nested directory structure, including any parent directories that don’t exist.
mkdir -p /home/user/projects/newprojectThis will create the projects and newproject directories, even if projects does not exist.
-v: Verbose mode, which displays a message for each directory created.
mkdir -v mydirOutput:
mkdir: created directory 'mydir'-m: Set the permissions for the new directory using octal mode (like chmod). For example, to create a directory with specific permissions:
mkdir -m 755 mydirThis will create mydir with rwxr-xr-x permissions, where the owner has read, write, and execute permissions, and others only have read and execute.
Create multiple directories at once:
mkdir dir1 dir2 dir3This creates three directories: dir1, dir2, and dir3.
Create nested directories:
mkdir -p /home/user/projects/project1/srcThis creates the entire path if it doesn’t exist: projects/project1/src.
Create a directory with specific permissions:
mkdir -m 700 private_folderThis creates a directory named private_folder with the following permissions:
-
Owner: Read, write, and execute (rwx)
-
Group: No permissions (---)
-
Others: No permissions (---)
In symbolic notation, the permissions are represented as rwx------, meaning only the owner has full access to the directory.
Verbose directory creation:
mkdir -v myfolderThis will display a message confirming the creation of the directory.
Summary:
-
The
mkdircommand is used to create new directories. -
The
-poption allows for creating parent directories if they do not exist. -
The
-moption lets you set permissions while creating a directory, and the-voption shows messages for each created directory.
8. cat - Concatenate and display file content
The cat command in Linux is used to concatenate (join) and display the content of files. It can read and print the content of one or more files to the terminal.
Basic Syntax:
cat [options] filename-
filename: The name of the file you want to display.
Examples:
cat file1.txtThis displays the contents of file1.txt in the terminal.
View a file's content:
cat file1.txtView multiple files together:
cat file1.txt file2.txtThis will display the contents of file1.txt followed by file2.txt.
Create a new file:
cat > newfile.txtAfter typing the command, you can input content for newfile.txt and press Ctrl+D to save.
Append to a file:
cat >> file.txtThis allows you to add content to the end of file.txt.
Summary:
-
catis used to display the contents of files in the terminal. -
It can also be used to combine multiple files or create new ones.
9. less - View file content one screen at a time
The less command in Linux is used to view the content of a file one screen at a time. It is useful for reading large files without overwhelming the terminal.
Basic Syntax:
less filename-
filename: The name of the file you want to view.
Example:
less largefile.txtThis opens largefile.txt and lets you scroll through its content.
Key Features:
-
Scroll: You can navigate up and down through the file using the arrow keys,
Page Up,Page Down, or spacebar. -
Exit: Press
qto quitlessand return to the terminal. -
Search: Press / and type a keyword to search within the file.
Summary:
-
lesslets you view large files one page at a time. -
You can navigate through the file and search for text, making it easier to read large files compared to commands like
cat.
10. grep - Print lines matching a pattern
The grep command in Linux is used to search for lines that match a specific pattern in a file or output. It looks for the pattern you specify and prints the matching lines.
Basic Syntax:
grep [options] "pattern" filename-
"pattern": The word or text you're searching for. -
filename: The file where you want to search for the pattern.
Examples:
grep "hello" file1.txtThis searches for the word "hello" in file1.txt and prints any line that contains it.
-i: Ignore case (case-insensitive search).
grep -i "hello" file1.txtThis finds "hello", "Hello", or "HELLO".
-r: Search recursively through directories.
grep -r "pattern" /path/to/directory-n: Show line numbers for matched lines.
grep -n "hello" file1.txtSummary:
-
grepis used to search for a specific pattern or word in a file. -
It prints the lines where the pattern is found, making it useful for quickly finding information in large files.
11. sudo - Execute a command as another user (usually with root privileges)
The sudo command in Linux stands for "superuser do". It allows you to execute commands with the privileges of another user, typically the root user, which has full control over the system.
Basic Syntax:
sudo command-
command: The command you want to run with elevated privileges.
Example:
sudo apt updateThis command runs apt update with root privileges, allowing it to update the package list for the system.
Key Features:
-
Permission: Only users who are authorized (usually specified in the
/etc/sudoersfile) can usesudo. -
Temporary Privileges: You may be prompted to enter your password to confirm your identity, and you can then run the command without needing the root password.
-
Log Actions: Commands run with
sudoare logged for security auditing.
Summary:
-
sudoallows you to run commands with higher privileges, which is often necessary for tasks like installing software or modifying system files. -
It helps maintain security by allowing controlled access to administrative tasks without sharing the root password.
12. ssh - OpenSSH SSH client (remote login program)
The ssh command in Linux stands for Secure Shell. It is a protocol used to securely log into a remote computer or server over a network. The ssh command is part of the OpenSSH package and provides a secure way to access and manage remote systems.
Basic Syntax:
ssh [user@]hostname-
user: (optional) The username you want to log in as on the remote machine. If omitted, it defaults to the current user's name. -
hostname: The IP address or domain name of the remote computer you want to connect to.
Examples:
ssh user@example.comThis command logs you into the remote server at example.com using the username user.
-p port: Specify a different port if the SSH server is running on a port other than the default (22).
ssh -p 2222 user@example.com-i identity_file: Use a specific SSH key for authentication.
ssh -i /path/to/private_key user@example.comKey Features:
-
Encryption: SSH encrypts the connection, ensuring that data transmitted over the network is secure from eavesdroppers.
-
Authentication: You can authenticate using a password or SSH keys for added security.
-
Port Forwarding: SSH allows you to forward ports securely, which can be used to tunnel other connections through the secure SSH connection.
-
File Transfer: You can use
scporsftp, which are part of the SSH suite, to securely transfer files between machines.
Summary:
-
sshis a command-line tool used to securely connect to remote computers. -
It provides a secure channel for remote login, making it essential for managing servers and performing administrative tasks remotely.
13. man - Display manual pages for commands
The man command in Linux stands for manual. It is used to display the manual pages (help documentation) for other commands and programs in the terminal. This is a valuable resource for learning how to use commands, understanding their options, and finding examples.
Basic Syntax:
man command-
command: The name of the command you want to learn about.
Example:
man lsThis command displays the manual page for the ls command, which lists the contents of a directory.
Key Features:
-
Sections: The manual is organized into sections, covering topics like commands, system calls, library functions, and more.
-
Navigation: You can scroll through the manual pages using the arrow keys,
Page Up,Page Down, and you can exit by pressingq. -
Search: Within the manual, you can search for specific terms by pressing /, typing the term, and hitting
Enter.
Common Sections in the Manual:
-
User Commands: General commands available to users.
-
System Calls: Functions that programs can call to interact with the kernel.
-
Library Functions: Functions provided by system libraries.
-
Special Files: Information about device files.
-
File Formats and Conventions: Descriptions of file formats and conventions.
Summary:
-
The
mancommand is used to access detailed documentation for commands in Linux. -
It helps users understand how to use commands effectively, providing options, syntax, and examples.
14. nano - Simple text editor
The nano command in Linux is a simple text editor that allows you to create and edit text files in the terminal. It is user-friendly and often preferred by beginners due to its straightforward interface.
Basic Syntax:
nano filename-
filename: The name of the file you want to create or edit. If the file does not exist,nanowill create it.
Example:
nano myfile.txtThis opens myfile.txt in the nano editor for editing.
Key Features:
-
Basic Editing: You can type, delete, and edit text easily.
-
Navigation: Use the arrow keys to move around the text.
-
Shortcuts: Common actions (like saving and exiting) are performed using keyboard shortcuts:
-
Ctrl + O: Save the file (write out). -
Ctrl + X: Exit the editor. -
Ctrl + K: Cut the current line. -
Ctrl + U: Paste the cut line.
-
Summary:
-
nanois a simple and easy-to-use text editor for creating and editing text files directly in the terminal. -
Its straightforward interface and keyboard shortcuts make it accessible for users of all skill levels.
15. vim - Vi Improved, a text editor
The vim command in Linux stands for Vi IMproved. It is a powerful text editor that is an enhanced version of the original vi editor. vim is widely used for editing text and programming due to its rich features and flexibility.
Basic Syntax:
vim filename-
filename: The name of the file you want to create or edit. If the file does not exist, vim will create it.
Example:
vim myfile.txtThis opens myfile.txt in the vim editor for editing.
Key Features:
-
Modes:
vimoperates in different modes:-
Normal Mode: For navigating and editing text (default mode).
-
Insert Mode: For entering text. You can switch to this mode by pressing
i. -
Command Mode: For executing commands, accessed by pressing
:.
-
-
Navigation: You can use keyboard shortcuts to navigate through the text (e.g., arrow keys,
h,j,k,l). -
Saving and Exiting:
-
To save changes and exit, type
:wqand pressEnter. -
To exit without saving, type
:q!and pressEnter.
-
Summary:
-
vimis a powerful text editor used for editing files and programming. -
It offers advanced features but has a steeper learning curve compared to simpler editors like
nano. -
Understanding its modes and commands is essential for efficient use.
16. touch - Create an empty file or update file timestamps
The touch command in Linux is used to create an empty file or to update the timestamps (access and modification times) of an existing file.
Basic Syntax:
touch filename-
filename: The name of the file you want to create or update.
Example:
touch myfile.txtThis command will create an empty file named myfile.txt if it doesn’t already exist. If it does exist, touch will update its timestamps to the current time.
Key Features:
-
Create an Empty File: If you specify a filename that doesn't exist,
touchwill create a new, empty file. -
Update Timestamps: If the file already exists,
touchwill change its last modified and last accessed times to the current time without modifying its content.
Summary:
-
The
touchcommand is a simple way to create new empty files or update the timestamps of existing files. -
It’s commonly used in scripting and file management tasks.
17. chmod - Change file permissions
The chmod command in Linux stands for change mode. It is used to change the permissions of files and directories. File permissions determine who can read, write, or execute a file.
Basic Syntax:
chmod options permissions filename-
options: Additional options (usually not needed for basic use). -
permissions: The new permissions you want to set (can be numeric or symbolic). -
filename: The name of the file or directory whose permissions you want to change.
Example:
chmod 755 myfile.txtThis command sets the permissions of myfile.txt so that:
-
The owner can read, write, and execute (7).
-
The group can read and execute (5).
-
Others can read and execute (5).
Understanding Permissions:
-
Numeric Method:
-
r(read) = 4 -
w(write) = 2 -
x(execute) = 1 -
Add these numbers to set permissions (e.g.,
7=4+2+1).
-
-
Symbolic Method:
-
Use letters to set permissions:
u(user/owner),g(group),o(others). -
Example:
-
chmod u+x myfile.txt (adds execute permission for the owner).
-
-
Summary:
-
The
chmodcommand is used to change file and directory permissions. -
Properly setting permissions is crucial for system security and controlling access to files.
18. chown - Change file owner
The chown command in Linux stands for change owner. It is used to change the owner of a file or directory. This command allows you to specify which user should have ownership of a particular file.
Basic Syntax:
chown new_owner filename-
new_owner: The username of the new owner you want to assign. -
filename: The name of the file or directory whose owner you want to change.
Example:
chown john myfile.txtThis command changes the owner of myfile.txt to the user john.
Key Features:
-
Ownership: Each file and directory has an owner (the user who created it) and a group associated with it. Changing ownership can affect who has permission to access or modify the file.
-
Recursive Change: You can change the owner of all files within a directory by using the
-Roption:bashchown -R john /path/to/directory
Summary:
-
The
chowncommand is used to change the owner of files and directories in Linux. -
This is useful for managing file permissions and access control in multi-user environments.
19. ps - Report a snapshot of current processes
The ps command in Linux stands for process status. It is used to display information about the currently running processes on the system. This includes details such as the process ID (PID), the terminal associated with the process, CPU and memory usage, and the command that started the process.
Basic Syntax:
ps [options]Common Options:
-
ps: Without any options, it shows processes running in the current terminal. -
ps aux: Displays all running processes for all users in a detailed format.-
a: Show processes for all users. -
u: Provide detailed information about the processes. -
x: Show processes not attached to a terminal.
-
Example:
ps auxThis command lists all processes currently running, along with their details.
Key Features:
-
PID: The unique identifier for each process.
-
USER: The username of the person who owns the process.
-
%CPU: The percentage of CPU usage.
-
%MEM: The percentage of memory usage.
-
VSZ: Virtual memory size of the process.
-
RSS: Resident Set Size (physical memory used).
-
TTY: The terminal associated with the process.
-
START: The time when the process started.
-
COMMAND: The command that initiated the process.
Summary:
-
The
pscommand is used to report a snapshot of the current processes running on the system. -
It is a valuable tool for monitoring system activity and resource usage.
20. top - Display Linux processes
The top command in Linux is used to display real-time information about the currently running processes on the system. It provides a dynamic, continuously updated view of system activity, including CPU usage, memory usage, and process information.
Basic Syntax:
Simply type top in the terminal and press Enter:
topKey Features:
-
Real-Time Monitoring: The
topcommand updates the displayed information every few seconds, allowing you to monitor system performance in real-time. -
Process Information: It shows a list of processes with various details, including:
-
PID: Process ID.
-
USER: The owner of the process.
-
PR: Process priority.
-
NI: Nice value (priority adjustment).
-
VIRT: Virtual memory used by the process.
-
RES: Resident memory (physical RAM used).
-
SHR: Shared memory.
-
S: Process status (running, sleeping, etc.).
-
%CPU: CPU usage percentage.
-
%MEM: Memory usage percentage.
-
TIME+: Total CPU time consumed by the process.
-
COMMAND: The command that started the process.
-
-
System Summary: At the top of the top display, you can see overall system statistics, such as:
-
Total tasks (running, sleeping, stopped, zombie).
-
CPU usage (user, system, idle).
-
Memory usage (total, used, free, buffers, cached).
-
Interactive Commands:
-
While
topis running, you can use various keyboard shortcuts to control its behavior:-
h: Display help information. -
k: Kill a process (you'll be prompted for the PID). -
r: Change the priority of a process. -
q: Quit the top command.
-
Summary:
-
The
topcommand is a powerful tool for monitoring system processes and performance in real-time. -
It provides essential information for system administration and troubleshooting, allowing users to identify resource-intensive processes and manage system performance effectively.
21. kill - Send a signal to a process
The kill command in Linux is used to send a signal to a process, which can instruct the process to terminate, pause, or perform other actions based on the signal sent. Despite its name, kill can do more than just terminate processes; it can also send various types of signals.
Basic Syntax:
kill [options] PID-
PID: The Process ID of the process you want to send a signal to.
Common Signals:
-
SIGTERM(15): The default signal sent by the kill command. It politely requests a process to terminate gracefully, allowing it to clean up resources before exiting. -
SIGKILL(9): Forces a process to terminate immediately without performing any cleanup. This signal cannot be ignored or handled by the process. -
SIGSTOP(19): Pauses (stops) the process. The process remains in the background and can be resumed later. This signal cannot be caught or ignored. -
SIGCONT(18): Resumes a paused (stopped) process that was previously halted bySIGSTOPorSIGTSTP.
Example:
To gracefully terminate a process:
kill 1234This sends the default SIGTERM signal to the process with PID 1234.
To forcefully kill a process:
kill -9 1234This sends the SIGKILL signal to the process with PID 1234.
To pause a process:
kill -19 1234This sends the SIGSTOP signal to the process.
Summary:
-
The
killcommand is a vital tool for managing processes in Linux by sending various signals to them. -
It's commonly used for terminating unresponsive processes, pausing tasks, or managing system resources effectively.
22. apt, yum, dnf - Package management tool
The apt, yum, and dnf commands are package management tools used in Linux distributions to handle software installation, removal, and management. Each tool is associated with different Linux distributions and serves a similar purpose.
APT (Advanced Package Tool)
-
Usage: Primarily used in Debian-based systems like Ubuntu.
-
Basic Commands:
-
Update Package List:
bashsudo apt updateThis command refreshes the list of available packages and their versions.
-
Upgrade Installed Packages:
bashsudo apt upgradeThis command upgrades all installed packages to their latest versions.
-
Install a Package:
bashsudo apt install package_nameThis installs a specific package.
-
Remove a Package:
bashsudo apt remove package_nameThis removes a specific package.
-
YUM (Yellowdog Updater Modified)
-
Usage: Used in older Red Hat-based systems like CentOS and Fedora.
-
Basic Commands:
-
Update Package List and Upgrade:
bashsudo yum updateThis command updates the package list and upgrades installed packages.
-
Install a Package:
bashsudo yum install package_nameThis installs a specific package.
-
Remove a Package:
bashsudo yum remove package_nameThis removes a specific package.
-
DNF (Dandified YUM)
-
Usage: The next-generation version of YUM, used in newer Red Hat-based systems like Fedora and CentOS 8.
-
Basic Commands:
-
Update Package List and Upgrade:
bashsudo dnf updateThis command updates the package list and upgrades installed packages.
-
Install a Package:
bashsudo dnf install package_nameThis installs a specific package.
-
Remove a Package:
bashsudo dnf remove package_nameThis removes a specific package.
-
Summary:
-
aptis used for Debian-based distributions, whileyumanddnfare used for Red Hat-based distributions. -
These package management tools simplify software management on Linux systems by handling package installation, updates, and removal efficiently.
-
They also manage dependencies, ensuring that all necessary libraries and packages are installed for a given application to function correctly.
23. wget - Retrieve files using HTTP, HTTPS and FTP
The wget command in Linux is a powerful utility used to retrieve files from the web via HTTP, HTTPS, and FTP protocols. It is commonly used for downloading files from the internet and can handle various types of downloads, including single files, directories, and entire websites.
Basic Syntax:
wget [options] [URL]-
[options]: Optional flags to modify the behavior of the command. -
[URL]: The web address of the file you want to download.
Example:
To download a single file:
wget http://example.com/file.zipTo download a website recursively:
wget -r http://example.com/-O filename: Save the downloaded file with a specific name.
wget -O custom_name.txt http://example.com/file.txt-r: Recursively download files (used for downloading entire websites or directories).
wget -r http://example.com/directory/-P directory: Specify a directory to save the downloaded files.
wget -P /path/to/directory http://example.com/file.txt--limit-rate=rate: Limit the download speed to a specified rate.
wget --limit-rate=200k http://example.com/file.zip-c: Continue an incomplete download. This is useful for resuming large files.
wget -c http://example.com/largefile.zip--no-check-certificate: Bypass SSL certificate checks (useful for self-signed certificates).
wget --no-check-certificate https://example.com/file.zipSummary:
-
The
wgetcommand is a versatile tool for downloading files from the internet in Linux. -
It supports various protocols (HTTP, HTTPS, FTP) and offers a wide range of options to customize the download process, making it particularly useful for both casual users and system administrators.
24. curl - Transfer data from or to a server
The curl command in Linux is a versatile tool used to transfer data to or from a server using various protocols, including HTTP, HTTPS, FTP, SCP, SFTP, and more. It is commonly used for downloading files, sending data to APIs, and testing web services.
Basic Syntax:
curl [options] [URL]-
[options]: Optional flags to modify the behavior of the command. -
[URL]: The address of the server to connect to.
Example:
To download a file:
curl -O http://example.com/file.zipTo send a JSON POST request to an API:
curl -H "Content-Type: application/json" -d '{"key":"value"}' -X POST http://example.com/api-O: Save the output to a file with the same name as the remote file.
curl -O http://example.com/file.zip-o filename: Save the output to a specified file.
curl -o custom_name.zip http://example.com/file.zip-L: Follow redirects. This is useful for URLs that redirect to another location.
curl -L http://example.com/redirected_url-d: Send data with a POST request (useful for APIs).
curl -d "param1=value1¶m2=value2" -X POST http://example.com/api-H: Add custom headers to the request.
curl -H "Authorization: Bearer token" http://example.com/api-I: Fetch only the HTTP headers.
curl -I http://example.com-u username:password: Authenticate with a username and password.
curl -u user:pass http://example.com/protectedSummary:
-
The
curlcommand is a powerful tool for transferring data between a client and a server in Linux. -
It supports a wide range of protocols and options, making it highly flexible for various data transfer tasks, including file downloads and API interactions. Make sure to install it if it is not already available on your system.
25. ping - Send ICMP ECHO_REQUEST to network hosts
The ping command in Linux is used to test the reachability of a network host by sending Internet Control Message Protocol (ICMP) ECHO_REQUEST packets. It is a fundamental tool for diagnosing network connectivity issues and measuring round-trip time.
Basic Syntax:
ping [options] destination-
destination: The IP address or hostname of the target you want to ping.
Example:
To ping a website, you can use:
ping example.comThis command sends ICMP ECHO_REQUEST packets to example.com, displaying the response time and packet loss statistics.
Key Features:
-
Continuous Operation: By default,
pingcontinues to send packets until interrupted. You can stop it by pressingCtrl + C. -
Packet Count: You can specify the number of packets to send with the
-coption:bashping -c 4 example.com -
This command sends 4 ICMP packets to the target.
-
Timeout and Interval Options: You can adjust the wait time between packets with the -i option, or set a timeout for responses with the
-Woption.
Summary:
-
The
pingcommand is a simple yet powerful tool for testing network connectivity and diagnosing issues. -
It is generally available by default in most Linux distributions, coming from the
iputilspackage. -
It is widely used by network administrators and users to verify the status of network hosts and troubleshoot connectivity problems.
26. ifconfig (or ip) - Configure network interface parameters
The ifconfig command (short for "interface configuration") is used in Linux to configure network interface parameters. It allows users to view and change the configuration of network interfaces, such as IP addresses, netmasks, and MAC addresses. The ip command is a more modern alternative that provides similar functionality with additional features and is recommended for use in newer systems.
Basic Syntax:
ifconfig:
ifconfig [interface] [options]-
interface: The name of the network interface (e.g.,
eth0,wlan0).
ip:
ip [options] [command] [parameters]Example:
-
Using ifconfig:
To display the current network configuration:
bashifconfigTo set an IP address on a specific interface:
bashsudo ifconfig eth0 192.168.1.10 netmask 255.255.255.0 up -
Using ip:
To display the current network configuration:
baship addr showTo set an IP address on a specific interface:
bashsudo ip addr add 192.168.1.10/24 dev eth0
Key Features:
-
View Configuration: Both commands allow you to view the current configuration of network interfaces, including IP addresses, netmasks, and hardware addresses (MAC).
-
Modify Configuration: You can modify interface parameters, such as changing the IP address or enabling/disabling an interface.
-
Multi-Protocol Support: The
ipcommand supports both IPv4 and IPv6, making it more versatile for modern networking needs.
Summary:
-
The
ifconfigandipcommands are used to configure network interface parameters in Linux. -
While
ifconfigis part of the oldernet-toolspackage,ipis part of the moderniproute2package and is generally preferred for managing network configurations today. -
Both commands provide essential functionality for network management.
27. tar - Tape archiving utility
The tar command in Linux is used for creating and manipulating archive files. It is commonly used to compress multiple files and directories into a single file, making it easier to store, share, or transfer them.
Basic Syntax:
tar [options] [archive-file] [file-or-directory-to-archive]Example:
Create an Archive: To create a tar archive named archive.tar from the directory myfolder:
tar -cvf archive.tar myfolder-
c: Create a new archive. -
v: Verbose mode (show progress in the terminal). -
f: Specify the archive filename.
Extract an Archive: To extract the contents of archive.tar:
tar -xvf archive.tar-
x: Extract files from an archive.
Create a Compressed Archive: To create a compressed tar.gz archive named archive.tar.gz:
tar -czvf archive.tar.gz myfolder-
z: Compress the archive using gzip.
Extract a Compressed Archive: To extract a tar.gz archive:
tar -xzvf archive.tar.gzList Contents of an Archive: To list the contents of archive.tar without extracting:
tar -tvf archive.tarKey Features:
-
Compression: The
tarcommand can create compressed archives using gzip or bzip2, reducing file size. -
Archiving: It can archive multiple files and directories into a single file, which simplifies file management and distribution.
-
Preservation of Metadata: When creating archives,
tarpreserves file permissions, timestamps, and directory structure.
Summary:
-
The
tarcommand is a versatile tool in Linux for creating, extracting, and managing archive files. -
It is widely used for backups, file compression, and distribution of multiple files and directories.
-
With support for compression and preservation of file attributes,
taris essential for effective file management in Linux environments.
28. gzip - Compress or expand files
The gzip command in Linux is used to compress or expand files, reducing their size for storage or transmission. It is commonly used to compress single files, and it creates files with the .gz extension.
Basic Syntax:
gzip [options] [file]Example:
Compress a File: To compress a file named example.txt:
gzip example.txtThis will create example.txt.gz and remove the original file.
Decompress a File: To decompress a file named example.txt.gz:
gzip -d example.txt.gzAlternatively, you can use:
gunzip example.txt.gzCompress Multiple Files: To compress multiple files at once:
gzip file1.txt file2.txtThis will create file1.txt.gz and file2.txt.gz, removing the original files.
Keep Original Files: To compress a file while keeping the original:
gzip -k example.txtView Compression Info: To display information about a compressed file:
gzip -l example.txt.gzKey Features:
-
High Compression Ratio:
gzipuses the DEFLATE algorithm, providing effective compression for text and other types of files. -
Stream Processing: It can compress data streams directly from input/output, making it suitable for use in pipelines.
Summary:
-
The
gzipcommand is a powerful utility in Linux for compressing and decompressing files, which helps save disk space and speed up file transfers. -
It is widely used due to its efficiency and ease of use.
-
With features for managing multiple files and maintaining original files,
gzipis an essential tool for effective file management in Linux environments.
29. unzip - List, test and extract compressed files in a ZIP archive
The unzip command in Linux is used to extract files from ZIP archives. It can also list the contents of a ZIP file and test the integrity of the compressed files.
Basic Syntax:
unzip [options] [zipfile.zip]Example:
Extract a ZIP File: To extract all files from archive.zip:
unzip archive.zipList Contents of a ZIP File: To list the contents without extracting:
unzip -l archive.zipExtract to a Specific Directory: To extract files to a specified directory:
unzip archive.zip -d /path/to/directoryTest ZIP File Integrity: To test the integrity of the files in archive.zip:
unzip -t archive.zipKey Features:
-
Partial Extraction: You can extract specific files from a ZIP archive.
-
Directory Structure: Maintains the original directory structure when extracting files.
-
File Integrity Testing: Tests the integrity of the compressed files before extraction.
Summary:
-
The
unzipcommand is a versatile tool for managing ZIP archives in Linux. -
It allows users to extract, list, and test files within ZIP files easily.
-
With its support for maintaining directory structures and verifying file integrity,
unzipis essential for handling compressed files effectively.
30. find - Search for files in a directory hierarchy
The find command in Linux is used to search for files and directories within a directory hierarchy based on various criteria like name, size, modification time, etc.
Basic Syntax:
find [path] [options] [expression]Example:
Find Files by Name: To find all files named example.txt in the current directory and subdirectories:
find . -name example.txtFind Files by Type: To find all directories in /home:
find /home -type dFind Files by Size: To find files larger than 10MB:
find . -size +10MFind and Execute a Command: To find and delete all .log files:
find . -name "*.log" -exec rm {} \;Key Features:
-
Search by name, type, size, modification date, etc.
-
Execute actions (e.g., delete, move, or modify files) on matching files.
-
Recursive search through directory hierarchies.
Summary:
-
The
findcommand is a powerful tool for locating files and directories based on various attributes in Linux. -
Its versatility allows for complex searches and the ability to perform operations on the found files, making it essential for file management tasks.
31. df - Report file system disk space usage
The df command in Linux displays the amount of disk space used and available on file systems.
Basic Syntax:
df [options]Example:
Display Disk Usage: To display disk space usage for all file systems:
dfHuman-Readable Format: To display disk usage in a human-readable format (e.g., MB, GB):
df -hDisplay Specific File System: To check the space on a specific file system or partition:
df /dev/sda1Key Features:
-
Human-readable output (-h option for easier understanding).
-
Shows total, used, and available space on all mounted file systems.
-
Works with specific file systems, partitions, or directories.
Summary:
-
Reports disk space usage.
-
Provides human-readable options.
-
Works on specific file systems or partitions.
-
Useful for system monitoring and management.
32. du - Estimate file space usage
The du command in Linux displays the disk usage of files and directories.
Basic Syntax:
du [options] [path]Example:
Display Disk Usage for a Directory: To display disk usage for the current directory and its subdirectories:
duHuman-Readable Format: To show disk usage in a human-readable format (e.g., KB, MB):
du -hSummarize Total Disk Usage: To display only the total disk usage for a directory:
du -sh /path/to/directoryShow Disk Usage for Files: To include individual file sizes along with directories:
du -aKey Features:
-
Estimates disk usage recursively for directories and subdirectories.
-
Human-readable option (
-h) to show sizes in KB, MB, GB. -
Summarizes total usage for specified directories.
-
Supports showing individual file sizes (
-aoption).
Summary:
-
Estimates file and directory space usage.
-
Displays human-readable sizes with
-h. -
Summarizes disk usage for directories.
-
Useful for tracking storage consumption.
33. free - Display amount of free and used memory in the system
The free command in Linux shows the total, used, and available memory (RAM) and swap space in the system.
Basic Syntax:
free [options]Example:
Display Memory Usage: To show memory and swap usage:
freeHuman-Readable Format: To display memory in a human-readable format (e.g., MB, GB):
free -hDisplay in Megabytes: To show memory in megabytes:
free -mShow Memory in Gigabytes:
free -gKey Features:
-
Displays total, used, free, and available memory.
-
Human-readable output (
-hoption for easier understanding). -
Shows detailed memory statistics including RAM and swap space.
Summary:
-
Displays system memory usage.
-
Supports human-readable output with
-h. -
Shows statistics for both RAM and swap.
-
Useful for monitoring system performance and memory consumption.
34. history - Command History
The history command in Linux displays the list of previously executed commands in the terminal.
Basic Syntax:
history [options] [number]Example:
Display Command History: To display all previously executed commands:
historyRun a Specific Command from History: To rerun the 15th command from history:
!15Clear Command History: To clear the history list:
history -cKey Features:
-
Displays previously executed commands with corresponding line numbers.
-
Rerun commands from history using
!n, wherenis the command number. -
Clear history with
-coption.
Summary:
-
Lists past terminal commands.
-
Supports rerunning commands from history.
-
Can clear command history for privacy.
-
Useful for recalling or reusing commands.
35. passwd - Change user password
The passwd command in Linux is used to change a user's password.
Basic Syntax:
passwd [options] [username]Example:
Change Current User Password: To change the password for the current user:
passwdChange Password for Another User (requires superuser privileges): To change the password for a specific user (e.g., john):
sudo passwd johnKey Features:
-
Prompts for the new password and confirmation for security.
-
Can be used by users to change their own passwords or by administrators to change others' passwords.
-
Optionally supports password aging policies.
Summary:
-
Used to change user passwords.
-
Can operate on the current user or specify another user.
-
Requires confirmation of the new password for security.
-
Essential for maintaining user account security.
36. uname - Print system information
The uname command in Linux is used to display basic information about the system's kernel and operating system.
Basic Syntax:
uname [options]Example:
Display Basic System Information: To print the system's kernel name:
unameDisplay All System Information: To print detailed system information (kernel name, version, machine, etc.):
uname -aKey Features:
-
Displays kernel and OS details such as kernel name, version, machine hardware name, and more.
-
Options for specific information like
-rfor kernel version,-nfor network node hostname.
Summary:
-
Prints kernel and system details.
-
Use
-afor comprehensive system information. -
Helpful for system diagnostics and identification.
37. date - Display or set the system date and time
The date command in Linux is used to display the current date and time or to set the system date and time.
Basic Syntax:
date [options] [+format]Example:
Display Current Date and Time: To display the current date and time:
dateDisplay Date in a Specific Format: To display the date in a custom format (e.g., YYYY-MM-DD):
date +"%Y-%m-%d"Set the System Date and Time (requires superuser privileges): To set the date and time to a specific value:
sudo date -s "2024-09-30 12:00:00"Key Features:
-
Custom formatting for displaying date and time using format specifiers.
-
Set the system date and time with the appropriate permissions.
-
Supports time zones and can display in UTC with
-u.
Summary:
-
Displays or sets the system date and time.
-
Supports custom formatting options.
-
Useful for time management and system configuration.
38. whoami - Print effective user id
The whoami command in Linux is used to display the username of the current user who is executing the command.
Basic Syntax:
whoamiExample:
Display Current User: To print the username of the currently logged-in user:
whoamiKey Features:
-
Quickly identifies the current user executing the command.
-
Useful in scripts to determine the effective user context.
Summary:
-
Prints the effective username of the current user.
-
Simple and straightforward to use.
-
Helpful for verifying user identity in multi-user environments.
39. which - Locate a command
The which command in Linux is used to identify the location of executable files associated with a specified command.
Basic Syntax:
which [options] commandExample:
Locate the Command: To find the path of the ls command:
which lsKey Features:
-
Shows the full path of the executable that will be run when a command is typed.
-
Can be used to verify which version of a command will be executed, especially in environments with multiple versions installed.
Summary:
-
Locates the executable file associated with a command.
-
Provides the path for clarity on which version is being used.
-
Useful for debugging and environment management.
40. alias - Create an alias for a command
The alias command in Linux is used to create shortcuts or custom names for commands, making it easier to execute long or complex commands.
Basic Syntax:
alias name='command'Example:
Create an Alias: To create an alias named ll for the ls -l command:
alias ll='ls -l'List All Aliases: To display all currently defined aliases:
aliasKey Features:
-
Simplifies command execution by allowing users to create shorter or more memorable names for longer commands.
-
Aliases are typically defined in the shell configuration files (like
.bashrcor.bash_profile) to persist across sessions.
Summary:
-
Creates shortcuts for commands to enhance productivity.
-
Improves efficiency by reducing the need to type lengthy commands.
-
Custom aliases can be defined per user and persist in the shell environment.
41. echo - Display a line of text
The echo command in Linux is used to display a line of text or a variable value in the terminal.
Basic Syntax:
echo [options] [string]Example:
Display Simple Text: To display a line of text:
echo "Hello, World!"Display Environment Variable: To display the value of an environment variable (e.g., HOME):
echo $HOMEKey Features:
-
Outputs text to the terminal and can include special characters.
-
Supports options like
-n(omit the trailing newline) and-e(enable interpretation of backslash escapes).
Summary:
-
Used to print text or variable values to the terminal.
-
Simple and versatile for scripting and command-line usage.
-
Supports various options for formatting output.
42. tail - Display the end of a file
The tail command in Linux is used to display the last part of files, typically to view the most recent entries in logs.
Basic Syntax:
tail [options] [file]Example:
Display Last 10 Lines of a File: To display the last 10 lines of a file named example.txt:
tail example.txtDisplay Last N Lines: To display the last 20 lines of a file:
tail -n 20 example.txtFollow a File: To continuously monitor a file (e.g., log file) for new entries:
tail -f example.logKey Features:
-
Displays the last part of a file, useful for checking log files.
-
Options allow customization, such as specifying the number of lines or following file changes in real time.
Summary:
-
Displays the end of files, particularly useful for logs and output monitoring.
-
Provides options for tailored output, including real-time updates.
-
A simple yet powerful tool for file inspection and monitoring.
43. head - Display the beginning of a file
The head command in Linux is used to display the first part of files, allowing users to quickly view the initial lines of text files.
Basic Syntax:
head [options] [file]Example:
Display the First 10 Lines of a File: To display the first 10 lines of a file named example.txt:
head example.txtDisplay the First N Lines: To display the first 15 lines of a file:
head -n 15 example.txtKey Features:
-
Displays the beginning of a file, useful for quickly checking file contents.
-
Options allow customization, such as specifying the number of lines to display.
Summary:
-
Displays the start of files, particularly useful for reviewing configuration files or data.
-
Provides options for tailored output, including specifying the number of lines.
-
A straightforward tool for quick content inspection.
44. diff - Compare files line by line
The diff command in Linux is used to compare the contents of two files line by line, highlighting the differences between them.
Basic Syntax:
diff [options] file1 file2Example:
Compare Two Files: To compare two text files named file1.txt and file2.txt:
diff file1.txt file2.txtKey Features:
-
Outputs differences in a human-readable format, indicating which lines need to be added or removed.
-
Supports various options for context and unified output formats, making it easier to read differences.
Summary:
-
Compares the contents of two files line by line, useful for identifying changes.
-
Provides a detailed output of differences, aiding in file management and version control.
-
A fundamental tool for developers and system administrators to track changes in files.
45. wc - Print newline, word, and byte counts for each file
The wc (word count) command in Linux is used to count the number of newlines, words, and bytes in files.
Basic Syntax:
wc [options] [file]Example:
Count Lines, Words, and Bytes: To count the lines, words, and bytes in a file named example.txt:
wc example.txtCount Only Lines: To count only the number of lines:
wc -l example.txtCount Only Words: Count Only Words:
wc -w example.txtKey Features:
-
Counts different metrics: Lines (
-l), words (-w), characters or bytes (-c), and more. -
Can process multiple files at once and provide cumulative counts.
Summary:
-
Provides statistics on the number of lines, words, and bytes in files.
-
Useful for file analysis and data processing.
-
A simple yet effective tool for text file management and evaluation.
46. sort - Sort lines of text files
The sort command in Linux is used to sort the lines of text files alphabetically or numerically.
Basic Syntax:
sort [options] [file]Example:
Sort a File Alphabetically: To sort the lines of a file named example.txt alphabetically:
sort example.txtSort in Reverse Order: To sort the lines in reverse alphabetical order:
sort -r example.txtSort Numerically: To sort the lines numerically (useful for sorting numbers):
sort -n numbers.txtKey Features:
-
Supports various sorting options: Reverse order (
-r), numeric sort (-n), and more. -
Can sort based on specific fields or columns with additional options.
Summary:
-
Sorts lines of text files in a specified order, enhancing file organization.
-
Provides various options for customized sorting based on requirements.
-
A fundamental tool for text processing and data management in Linux.
47. uniq - Report or omit repeated lines
The uniq command in Linux is used to filter out repeated lines in a file or input, allowing users to report unique lines.
Basic Syntax:
uniq [options] [input_file] [output_file]Example:
Remove Duplicate Lines: To remove adjacent duplicate lines from a file named example.txt and display the unique lines:
uniq example.txtCount Occurrences of Each Line: To count how many times each line appears:
uniq -c example.txtKey Features:
-
Removes consecutive duplicate lines: Only works with adjacent lines, so it's often used in conjunction with
sort. -
Can report the number of occurrences of each line with the
-coption.
Summary:
-
Filters and displays unique lines from input, useful for data processing.
-
Often used alongside the
sortcommand to prepare input foruniq. -
A simple yet powerful tool for managing and analyzing text data.
48. sed - Stream editor for filtering and transforming text
The sed (stream editor) command in Linux is used for parsing and transforming text in a pipeline, allowing users to perform basic text transformations on an input stream (file or input from a pipeline).
Basic Syntax:
sed [options] 'command' [file]Example:
Replace Text: To replace the first occurrence of "old" with "new" in a file named example.txt:
sed 's/old/new/' example.txtDelete Lines: To delete the second line of a file:
sed '2d' example.txtKey Features:
-
Text Replacement: Use the
scommand for substitution to modify text. -
Line Deletion: Easily delete specific lines using line numbers.
-
Supports Regular Expressions: Can perform complex text manipulations with regex.
Summary:
-
A powerful tool for editing text streams, commonly used in shell scripting and text processing.
-
Allows for both simple substitutions and complex text manipulations.
-
Essential for automation tasks that involve text processing in Linux environments.
49. awk - Pattern scanning and processing language
The awk command in Linux is a versatile programming language designed for pattern scanning and processing. It is used primarily for processing text files and data streams.
Basic Syntax:
awk 'pattern { action }' [file]Example:
Print Specific Columns: To print the first and third columns of a file named data.txt:
awk '{ print $1, $3 }' data.txtCalculate the Sum of a Column: To sum the values in the second column:
awk '{ sum += $2 } END { print sum }' data.txtKey Features:
-
Field Separation: Automatically splits each line into fields based on whitespace or a specified delimiter.
-
Built-in Functions: Supports various functions for string manipulation, mathematical operations, and more.
-
Pattern Matching: Can perform actions based on specified patterns using regular expressions.
Summary:
-
awkis a powerful text-processing tool ideal for extracting and manipulating data from structured text files. -
Commonly used in data reporting and processing tasks, especially for CSV and tab-delimited files.
-
Essential for scripting and automating data analysis in Linux environments.
50. cut - Remove sections from each line of files
The cut command in Linux is used to extract sections from each line of input files or standard input, making it useful for processing structured data.
Basic Syntax:
cut [options] [file]Example:
Extract Specific Fields: To extract the second and fourth fields from a comma-separated file named data.csv:
cut -d',' -f2,4 data.csvExtract Character Range: To extract the first 5 characters from each line of a file named text.txt:
cut -c1-5 text.txtKey Features:
-
Field Delimiter: Use the
-doption to specify a delimiter (e.g., comma, tab) to separate fields. -
Field Selection: Use the
-foption to select specific fields. -
Character Selection: Use the
-coption to select specific character positions.
Summary:
-
cutis a simple yet effective tool for extracting parts of lines in text files. -
Commonly used for processing CSV and tab-delimited files, as well as extracting substrings.
-
Valuable for text manipulation tasks in shell scripting and data processing in Linux environments.
Conclusion
Mastering the top 50 Linux commands can greatly enhance your productivity and efficiency, whether you're handling basic system operations, file management, or text editing tasks. By integrating these commands into your daily workflow, you can streamline your processes and make the most out of the Linux environment.
If you have any questions or encounter issues related to Linux systems or server management, don't hesitate to contact iDatam for expert support and solutions.
Discover iDatam Dedicated Server Locations
iDatam servers are available around the world, providing diverse options for hosting websites. Each region offers unique advantages, making it easier to choose a location that best suits your specific hosting needs.

















































































